SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2qx3_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2qx3_B
Domain Number 1 Region: 1-327
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.81e-65
Family SCOPe 0.00000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2qx3_B
Sequence length 330
Comment mol:protein length:330 Pectate lyase II
Sequence
gpvgygaattgggnkvpvnvatfeamqsaidsysgsgglvlnytgkfdfgtikdvcaqwk
lpaktvqiknksdvtikgangsaanfgirvvgnahnviiqnmtigllqggedadsisleg
nssgepskiwvdhntvfasltkcsgagdasfdggidmkkgvhhvtvsynyvynyqkvaln
gysdsdtknsaarttyhhnrfenvesrvplqrrglshiynnyfnnvttsginvrmggiak
iesnyfeniknpvtsrdsseigywdlinnyvgsgitwgtpdgskpyanatnwistkvfpe
slgyiytvtpaaqvkakviatagagknlae
Download sequence
Identical sequences 000167157|e2qx3A1|207.2.1.15|A:1-330 000337295|e2qx3B1|207.2.1.15|B:1-330 cath|current|2qx3A00/24-353 cath|current|2qx3B00/24-353 d2qx3a_ d2qx3b_ 2qx3_A 2qx3_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]