SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2qy1_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2qy1_B
Domain Number 1 Region: 1-327
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.17e-66
Family SCOPe 0.0000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2qy1_B
Sequence length 330
Comment mol:protein length:330 Pectate lyase II
Sequence
gpvgygagttgggnkvpvnvatfeamqsaidsysgsgglvlnytgkfdfgtikdvcaqwk
lpaktvqiknksdvtikgangsaanfgirvvgnahnviiqnmtigllqggedadsisleg
nssgepskiwvdhntvfasltkcsgagdasfdggidmkkgvhhvtvsynyvynyqkvaln
gysdsdtknsaarttyhhnrfenvesrvplqrfglshiynnyfnnvttsginvrmggiak
iesnyfeniknpvtsrdsseigywdlinnyvgsgitwgtpdgskpyanatnwistkvfpe
slgyiytvtpaaqvkakviatagagknlae
Download sequence
Identical sequences 000336914|e2qy1A1|207.2.1.15|A:1-330 000336915|e2qy1B1|207.2.1.15|B:1-330 cath|current|2qy1A00/24-353 cath|current|2qy1B00/24-353 2qy1_A 2qy1_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]