SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2uve_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2uve_B
Domain Number 1 Region: 161-279,328-564
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.27e-93
Family Galacturonase 0.0051
Further Details:      
 
Domain Number 2 Region: 35-153
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000113
Family Fibronectin type III 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2uve_B
Sequence length 608
Comment mol:protein length:608 EXOPOLYGALACTURONASE
Sequence
mqaqlqrprttgmlvimaslmvgtpmamaaksssldapqqlqvptlaydessivlvwkap
edtrkivdyqifsagkllgkasdnndnfspakpyidhfyvndkdnfqhkivmqnftvigl
kpetsyqftvkaqyadgslsvaskpitaktsakpqivnvrdfgaiddgktlntkaiqqai
dsckpgcrveipagtyksgalwlksdmtlnlqagaillgsenpddypagyrlypystier
paslinaidpnnskpgtfrniritgsgvidgngwlraktaeitdelgrslpqyvasknsk
vhedgilaknqvekavsdgmdlknaygqrrsslmtlrgvenvylagftvrnpafhgimnl
enhnvvanglihqtydanngdgiefgnsqnvmvfnnffdtgddcinfaagtgekaqeqep
mkgawlfnnyfrmghgaivtgshtgawiedilaennvmyltdiglrakststigggarnv
tfrnnamrdlakqvmvmtldyadsnanidyppakipaqfydftlknvtvdnstgknpsie
ikgdtankawhrlvhvnnvqlnnvtptaisdlrdsefnkvtftelrgdtpwhfsevknvk
vdgkpvap
Download sequence
Identical sequences 2uve_A 2uve_B 2uvf_A 2uvf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]