SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2uye_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2uye_A
Domain Number 1 Region: 90-297
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.18e-40
Family Phosphate binding protein-like 0.0000000963
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.73e-18
Family LysR-like transcriptional regulators 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2uye_A
Sequence length 307
Comment mol:protein length:307 REGULATORY PROTEIN
Sequence
mdlrdidlnllvvfnqllldrsvstageklgltqpavsnslkrlrtalnddlflrtskgm
eptpyalhlaepviyalntlqtalttrdsfdpfastrtfnlamtdigemsvmpplmeala
qraphiqistlrpnagnlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhp
sakspmslkqfselehvgvvalntghgevdglleragikrrmrlvvphfiaigpilhstd
liatvpqrfavrcevpfglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfse
ahhhhhh
Download sequence
Identical sequences 2uye_A 2uye_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]