SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2v73_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2v73_A
Domain Number 1 Region: 13-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.63e-25
Family Leech intramolecular trans-sialidase, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2v73_A
Sequence length 191
Comment mol:protein length:191 PUTATIVE EXO-ALPHA-SIALIDASE
Sequence
gmasikgevdeianygnlkitkeeervnitgdlekfssleegtivtrfnmndtsiqslig
lsdgnkannyfslyvsggkvgyelrrqegngdfnvhhsadvtfnrgintlalkiekgiga
kiflngslvktvsdpnikflnainlnsgfigktdrangyneylfrgnidfmniydkpvsd
nyllrktgetk
Download sequence
Identical sequences cath|current|2v73A00/5-187 cath|current|2v73B00/6-187 2v73_A 2v73_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]