SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2vfn_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2vfn_A
Domain Number 1 Region: 6-559
Classification Level Classification E-value
Superfamily Pectin lyase-like 0
Family P22 tailspike protein 0.000000000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2vfn_A
Sequence length 559
Comment mol:protein length:559 BIFUNCTIONAL TAIL PROTEIN
Sequence
mdpdqysieadkkfkysaklsdyptlqdaasaavdgllidrdynfyggetvdfggkvlti
eckakfigdgnliftklgkgsriagvfmestttpwvikpwtddnqwltdaaavvatlkqs
ktdgyqptvsdyvkfpgietllppnakgqnitstleirecigvevhrasglmagflfrgc
hfckmvdannpsggkdgiitfenlsgdwgkgnyviggrtsygsvssaqflrnnggferdg
gvigftsyragesgvktwqgtvgsttsrnynlqfrdsvviypvwdgfdlgadtdmnpeld
rpgdypitqyplhqlplnhlidnllvrgalgvgfgmdgkgmyvsnitvedcagsgayllt
hesvftniaiidtntkdfqanqiyisgacrvnglrligirstdgqsltidapnstvsgit
gmvdpsrinvanlaeeglgniransfgydsaaiklrihklsktldsgalyshinggagsg
saytqltaisgstpdavslkvnhkdcrgaeipfvpdiasddfikdsscflpywennstsl
kalvkkpngelvrltlatl
Download sequence
Identical sequences cath|current|2vfnA00/112-666 2vfn_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]