SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2wc8_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2wc8_C
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily EF-hand 1.43e-22
Family S100 proteins 0.0000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2wc8_C
Sequence length 95
Comment mol:protein length:95 PROTEIN S100-A12
Sequence
mggstkleehlegivnifhqysvrkghfdtlskgelkqlltkelantiknikdkavidei
fqgldanqdeqvdfqefislvaialkaahyhthke
Download sequence
Identical sequences 1odbA cath|current|1odbA00/0-90 cath|current|1odbB00/0-90 cath|current|1odbC00/0-90 cath|current|1odbD00/0-90 cath|current|1odbE00/0-90 cath|current|1odbF00/0-89 cath|current|2wc8A00/0-91 cath|current|2wc8B00/0-91 cath|current|2wc8C00/0-91 cath|current|2wc8D00/-1-91 cath|current|2wcbA00/0-91 cath|current|2wcbB00/0-90 cath|current|2wcfA00/0-90 cath|current|2wcfB00/0-90 cath|current|2wcfC00/-1-88 cath|current|2wcfD00/1-90 cath|current|2wcfE00/0-89 cath|current|2wcfF00/0-89 1odb_A 1odb_B 1odb_C 1odb_D 1odb_E 1odb_F 2wc8_A 2wc8_B 2wc8_C 2wc8_D 2wcb_A 2wcb_B 2wcf_A 2wcf_B 2wcf_C 2wcf_D 2wcf_E 2wcf_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]