SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2x3h_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2x3h_C
Domain Number 1 Region: 3-33
Classification Level Classification E-value
Superfamily PDB 0.00000000000344
Family PDB 0.00053
Further Details:      
 
Domain Number 2 Region: 78-348
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000149
Family SCOPe 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 2x3h_C
Sequence length 542
Comment mol:protein length:542 K5 LYASE
Sequence
mgsshhhhhhgmasmtggqqmgrdlyddddkdpssrsmakltkpktegilhkgqslyeyl
darvltskpfgaagdattddteviaaslnsqkavtisdgvfsssginsnycnldgrgsgv
lshrsstgnylvfnnprtgrlsnitvesnkatdttqgqqvslaggsdvtvsdvnfsnvkg
tgfsliaypndappdglmikgirgsysgyatnkaagcvladssvnslidnviaknypqfg
avelkgtasynivsnvigadcqhvtyngtegpiapsnnlikgvmannpkyaavvagkgst
nlisdvlvdystsdarqahgvtvegsdnvinnvlmsgcdgtnslgqrqtatiarfigtan
nnyasvfpsysatgvitfesgstrnfvevkhpgrrndllssastidgaatidgtsnsnvv
hapalgqyigsmsgrfewriksmslpsgvltsadkyrmlgdgavslavgggtssqvrlft
sdgtsrtvsltngnvrlstsstgylqlgadamtpdstgtyalgsasrawsggftqaaftv
ts
Download sequence
Identical sequences 2x3h_A 2x3h_B 2x3h_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]