SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3a2x_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3a2x_C
Domain Number 1 Region: 7-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.17e-79
Family Glutathione peroxidase-like 0.000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3a2x_C
Sequence length 249
Comment mol:protein length:249 Probable peroxiredoxin
Sequence
pgsipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvsttefvsfarry
edfqrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesa
thtvrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneii
geglivpppttedqararmesgqyrcldwwfcwdtpasrddveearrylrraaekpakll
yeearthlh
Download sequence
Identical sequences 3a2w_A 3a2w_B 3a2w_C 3a2w_D 3a2w_E 3a2w_F 3a2w_G 3a2w_H 3a2w_I 3a2w_J 3a2x_A 3a2x_B 3a2x_C 3a2x_D 3a2x_E 3a2x_F 3a2x_G 3a2x_H 3a2x_I 3a2x_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]