SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3a4r_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3a4r_A
Domain Number 1 Region: 10-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000194
Family SCOPe 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3a4r_A
Sequence length 79
Comment mol:protein length:79 NFATC2-interacting protein
Sequence
gplgsqelrlrvqgkekhqmleislspdsplkvlmshyeeamglsghklsfffdgtklsg
kelpadlglesgdlievwg
Download sequence
Identical sequences 3a4r_A 3a4r_B 3a4s_C 3a4s_D 000137946|e3a4rA1|221.1.1.27|A:1-79 000382440|e3a4rB1|221.1.1.27|B:1-79 cath|current|3a4rA00/-4-412 cath|current|3a4rB00/-4-412 cath|current|3a4sC00/339-412 cath|current|3a4sD00/340-411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]