SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3b4t_F from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3b4t_F
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.74e-43
Family SCOPe 0.00011
Further Details:      
 
Domain Number 2 Region: 160-243
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.5e-36
Family SCOPe 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3b4t_F
Sequence length 262
Comment mol:protein length:262 Ribonuclease PH
Sequence
gshvskredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatg
lgwltaeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaid
cdvlqadggtrtaaitgayvaladavtylsaagklsdprplscaiaavsvgvvdgrirvd
lpyeedsraevdmnvvatdtgtlveiqgtgegatfarstldklldmalgacdtlfaaqrd
alalpypgvlpqgppppkafgt
Download sequence
Identical sequences 3b4t_A 3b4t_B 3b4t_C 3b4t_D 3b4t_E 3b4t_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]