SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3b8y_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3b8y_B
Domain Number 1 Region: 118-299
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.99e-37
Family Pectate lyase-like 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3b8y_B
Sequence length 344
Comment mol:protein length:344 Endo-pectate lyase
Sequence
MFKYVIPLCALTLAAPSFAAQTTLMLSQKSDVNYLGWSTDESKVARQEVYRGTTSNPDLR
ERIAVLDAETRTFKDADTNSGLNYWYWVDVVSENQAQVVSNAVTTAPNAGPLRAAKASSE
CKPGATFENRTVDCGGVTIGTSCPNDSDKQKPLIILKNATVKNLRISASGGADGIHCDSG
NCTIENVIWEDICEDAATNNGKTMTIVGGIAHNAKDGYGGKPDKVLQHNSKNSTTVVKGN
FTLTGEHGKLWRSCGDCSNNGGPRFLTVTSATVNGTIDSIAGVNRNYGDVATISGLKIKN
YKEGKPPVCEEFKGVVKGQGSTEKYGEKWDTTNCKVSRSGVSKL
Download sequence
Identical sequences E0SM75
WP_013318842.1.88672 3b4n_A 3b4n_B 3b8y_A 3b8y_B gi|307131951|ref|YP_003883967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]