SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3c5f_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3c5f_A
Domain Number 1 Region: 150-334
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.11e-80
Family DNA polymerase beta-like 0.000000504
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 7.32e-35
Family DNA polymerase beta, N-terminal domain-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 90-144
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.31e-18
Family DNA polymerase beta-like, second domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3c5f_A
Sequence length 335
Comment mol:protein length:335 DNA polymerase lambda
Sequence
maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
gpgrrhrrldiivvpysefacallyftgsahfnrsmaalaktkgmslsehalstavvrnt
hgckvgpgrvlptptekdvfrllglpyrepaerdw
Download sequence
Identical sequences 3c5f_A 3c5f_B 3c5fA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]