SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3clu_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3clu_C
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.95e-87
Family ETFP subunits 0.00000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3clu_C
Sequence length 264
Comment mol:protein length:264 Electron transfer flavoprotein subunit beta
Sequence
MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKESSDTDVEVV
VVSVGPDRVDESLRKCLAKGADRAVRVWDDAAEGSDAIVVGRILTEVIKKEAPDMVFAGV
QSSDQAYASTGISVASYLNWPHAAVVADLQYKPGDNKAVIRRELEGGMLQEVEINCPAVL
TIQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDVGAAQSMSRVRRMYIPEKGRA
TMIEGTISEQAAKIIQIINEFKGA
Download sequence
Identical sequences P53570
cath|current|1o96A00/1-262 cath|current|1o96C00/1-261 cath|current|1o96E00/1-261 cath|current|1o96Q00/1-261 cath|current|1o97C00/1-261 cath|current|3clrC00/1-262 cath|current|3clsC00/1-262 cath|current|3cltC00/1-263 cath|current|3cluC00/1-261 1o94_C 1o94_E 1o95_C 1o95_E 1o96_A 1o96_C 1o96_E 1o96_Q 1o97_C 3clr_C 3cls_C 3clt_C 3clu_C 3clsC

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]