SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3df8_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3df8_A
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.52e-18
Family SCOPe 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3df8_A
Sequence length 111
Comment mol:protein length:111 possible HxlR family transcriptional factor
Sequence
snamlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstil
srrikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrngd
Download sequence
Identical sequences 3df8_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]