SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3eqn_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3eqn_A
Domain Number 1 Region: 46-364
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.7e-41
Family iota-carrageenase 0.074
Further Details:      
 
Domain Number 2 Region: 395-578,606-727
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.86e-30
Family Galacturonase 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3eqn_A
Sequence length 758
Comment mol:protein length:758 Glucan 1,3-beta-glucosidase
Sequence
eaeaeflgstcssplthgsaapgdpfwlqniqhqgiaafngnpggypvfrnvknygakgd
gntddtaaiqaainaggrcgqgcdstttqpalvyfppgtykvssplvvlyqtqligdakn
lptllaapnfsgialidadpylaggaqyyvnqnnffrsvrnfvidlrqvsgsatgihwqv
sqatslinivfqmstaagnqhqgifmengsggflgdlvfnggnigatfgnqqftvrnltf
nnantainaiwnwgwtfqritinncqvgfdltqggtsntgaqgvgaeaiidavvtntqtf
vrwsgassghlqgslvlnniqltnvpvavgvkggptvlaggtttinswaqgnvyhgtngn
ptftqgnianinrpgvlldstgrivskshpqytgyapsdfvsvrsqgakgdghtddtqai
knvfakyagckiiffdagtyivtdtiqipagtqivgevwsvimgtgskftdynnpqpviq
vgapgssgvveitdmifttrgpaagaiivewnvhdpsgqqaaagawdthliiggtaqsgl
qvgqcptsgaggnncfadflglhltsgssaylegmwvwladhdldsggsqqislwsnggi
msesqgpvwligtasehhinyqyflknaanhyiglaqtetpyfqpnpnppapfitnsnfd
psqlgqgdawamtvqnshgilvfgagfysffsayntgcqspqncqnqivnvdsssdiafy
slttvdttwqfsvnaqgvinrsnnpngfadtitawtrn
Download sequence
Identical sequences 3eqn_A 3eqn_B 3eqo_A 3eqo_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]