SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3evo_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3evo_A
Domain Number 1 Region: 7-139
Classification Level Classification E-value
Superfamily Nucleoside diphosphate kinase, NDK 1.32e-63
Family Nucleoside diphosphate kinase, NDK 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3evo_A
Sequence length 146
Comment mol:protein length:146 Nucleoside diphosphate kinase
Sequence
ykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehse
qsyfndncdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandirenli
hasdsedsavdeisiwfpetkmetdn
Download sequence
Identical sequences 3ejm_A 3ejm_B 3evo_A 3evo_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]