SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3eyt_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3eyt_A
Domain Number 1 Region: 5-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.18e-24
Family SCOPe 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3eyt_A
Sequence length 158
Comment mol:protein length:158 uncharacterized protein SPOA0173
Sequence
snamkapelqiqqwfnsatdltladlrgkvivieafqmlcpgcvmhgiplaqkvraafpe
dkvavlglhtvfehheamtpislkaflheyrikfpvgvdqpgdgamprtmaayqmrgtps
lllidkagdlrahhfgdvselllgaeiatllgeaapsv
Download sequence
Identical sequences 3eyt_A 3eyt_B 3eyt_C 3eyt_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]