SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3f6v_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3f6v_A
Domain Number 1 Region: 56-126
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.49e-35
Family ArsR-like transcriptional regulators 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3f6v_A
Sequence length 151
Comment mol:protein length:151 Possible transcriptional regulator, ArsR family protein
Sequence
mgsshhhhhhssgrenlyfqghmnsptsrplrrdplhnalvttnvlvvldqlevaaeptr
rrlvqlltsgeqtvnnlaahfpasrsaisqhlrvlteaglvtprkdgrfryyrldpqgla
qlralfdsfwideldrlvadateeaaskgds
Download sequence
Identical sequences 3f6v_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]