SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3h4p_h from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3h4p_h
Domain Number 1 Region: 2-202
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.45e-89
Family Proteasome subunits 0.0000000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3h4p_h
Sequence length 219
Comment mol:protein length:219 Proteasome subunit beta
Sequence
mtttvglicddavilatdkraslgnlvadkeakklykiddyiamtiagsvgdaqaivrll
iaeaklykmrtgrnipplacatllsnilhssrmfpfltqiiiggydllegaklfsldplg
gmneektftatgsgspiaygvleagydrdmsveegiklalnalksamerdtfsgngisla
vitkdgvkifedeeiekildsmkakpkkkttkrsrrksk
Download sequence
Identical sequences 3h4p_a 3h4p_b 3h4p_c 3h4p_d 3h4p_e 3h4p_f 3h4p_g 3h4p_h 3h4p_i 3h4p_j 3h4p_k 3h4p_l 3h4p_m 3h4p_n

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]