SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3hx0_F from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3hx0_F
Domain Number 1 Region: 150-334
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.76e-80
Family DNA polymerase beta-like 0.00000059
Further Details:      
 
Domain Number 2 Region: 3-87
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 3.07e-34
Family DNA polymerase beta, N-terminal domain-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 90-144
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 6.31e-18
Family DNA polymerase beta-like, second domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3hx0_F
Sequence length 335
Comment mol:protein length:335 DNA polymerase lambda
Sequence
maqpssqkatnhnlhiteklevlakaysvqgdkwraagyakainalksfhkpvtsyqeac
sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
gpgrrhrrldiivvpysefacallyftgsaafnasmralaktkgmslsehalstavvrnt
hgakvgpgrvlptptekdvfrllglpyrepaerdw
Download sequence
Identical sequences 3hx0_A 3hx0_F 3hx0_K 3hx0_P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]