SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3i64_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3i64_A
Domain Number 1 Region: 112-328
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.19e-74
Family Plant O-methyltransferase, C-terminal domain 0.0000988
Further Details:      
 
Domain Number 2 Region: 17-88
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.73e-30
Family Plant O-methyltransferase, N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3i64_A
Sequence length 332
Comment mol:protein length:332 O-methyltransferase
Sequence
MGKRAAHIGLRALADLATPMAVRVAATLRVADHIAAGHRTAAEIASAAGAHADSLDRLLR
HLVAVGLFTRDGQGVYGLTEFGEQLRDDHAAGKRKWLDMNSAVGRGDLGFVELAHSIRTG
QPAYPVRYGTSFWEDLGSDPVLSASFDTLMSHHLELDYTGIAAKYDWAALGHVVDVGGGS
GGLLSALLTAHEDLSGTVLDLQGPASAAHRRFLDTGLSGRAQVVVGSFFDPLPAGAGGYV
LSAVLHDWDDLSAVAILRRCAEAAGSGGVVLVIEAVAGDEHAGTGMDLRMLTYFGGKERS
LAELGELAAQAGLAVRAAHPISYVSIVEMTAL
Download sequence
Identical sequences Q84HC8
3i53_A 3i53_B 3i58_A 3i58_B 3i5u_A 3i5u_B 3i64_A 3i64_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]