SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3i69_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3i69_D
Domain Number 1 Region: 81-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.52e-45
Family Glutathione S-transferase (GST), C-terminal domain 0.0000488
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.01e-31
Family Glutathione S-transferase (GST), N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3i69_D
Sequence length 222
Comment mol:protein length:222 Glutathione S-transferase A1
Sequence
maekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmvei
dgmklvqtrailnyiaskynlygkdikeralidmyiegiadlgemiimlpfcppeekdak
lalikekiknryfpafekvlkshgqdylvgnklsradihlvellyyveeldsslissfpl
lkalktrisnlptvkkflqpgsprkpppdeiyvrtvynifrp
Download sequence
Identical sequences 3i69_A 3i69_B 3i69_C 3i69_D 3i69_E 3i69_F 3i69_G 3i69_H 3i6a_A 3i6a_B 3i6a_C 3i6a_D 3i6a_E 3i6a_F 3i6a_G 3i6a_H 3ik9_A 3ik9_B 3ik9_C 3ik9_D 3ik9_E 3ik9_F 3ik9_G 3ik9_H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]