SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3ikv_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3ikv_B
Domain Number 1 Region: 5-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.66e-36
Family Transcriptional repressor Rex, N-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 79-199
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.27e-28
Family Transcriptional repressor Rex, C-terminal domain 0.00000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3ikv_B
Sequence length 207
Comment mol:protein length:207 Redox-sensing transcriptional repressor rex
Sequence
gmkvpeaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrg
vgytvpvlkrelrhilglnrkwglcivgmgdlgsaladypgfgesfelrgffdvdpekvg
rpvrggviehvdllpqrvpgrieialltvpreaaqkaadllvaagikgilnfapvvlevp
kevavenvdflagltrlsfailnpkwr
Download sequence
Identical sequences 3ikv_A 3ikv_B 3il2_A 3il2_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]