SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3j6x_10 from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3j6x_10
Domain Number 1 Region: 42-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000162
Family SCOPe 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3j6x_10
Sequence length 105
Comment mol:protein length:105 40S ribosomal protein S10
Sequence
MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLTSKGYVKTQFS
WQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERNPTQRPQRRY
Download sequence
Identical sequences A0A0L8VGX7 A0A250WA61 A6ZPC8 B3LJV7 C8ZH43 G2WNF9 N1NYV2 Q08745
YOR293W YOR293W YOR293W YOR293W YOR293W YOR293W 4932.YOR293W SCRT_01673 YOR293W YOR293W YOR293W YOR293W YOR293W YOR293W YOR293W YOR293W YOR293W 3j6x_10 3j6y_10 3j77_10 3j78_10 4v88_AK 4v88_CK 4v8y_AK 4v8z_AK 5dat_C0 5dat_c0 5dc3_C0 5juo_HB 5jup_HB 5jus_HB 5jut_HB 5juu_HB 5mc6_C 5mei_L 5mei_c0 5ndg_C0 5ndg_c0 5ndv_C0 5ndv_c0 5ndw_C0 5ndw_c0 5obm_C0 5obm_c0 5on6_L 5on6_c0 5tbw_L 5tbw_c0 6gq1_AA 6gqb_AA 6gqv_AA YOR293W YOR293W NP_014936.1.97178 YOR293W YOR293W YOR293W tr|A6ZPC8|A6ZPC8_YEAS7 YOR293W YOR293W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]