SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3j81_Q from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3j81_Q
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-37
Family Translational machinery components 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3j81_Q
Sequence length 143
Comment mol:protein length:143 uS9
Sequence
MSTVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVQPEILRFKVYEPLLLVGLDKF
ANIDIRVKVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSKNELKKAFTSYDRTLLIAD
SRRPEPKKFGGRGARSRFQKSYR
Download sequence
Identical sequences Q875N2
cath|current|3j80Q00/3-143 cath|current|3j81Q00/3-143 XP_454946.1.35115 28985.Q875N2 3j80_Q 3j81_Q 3jam_Q 3jap_Q 3jaq_Q gnl|GLV|KLLA0E21979g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]