SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3j9z_LE from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3j9z_LE
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 5.42e-30
Family Ribosomal L11/L12e N-terminal domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 67-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.1e-25
Family Ribosomal protein L11, C-terminal domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3j9z_LE
Sequence length 141
Comment mol:protein length:141 50S ribosomal protein L11
Sequence
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtktppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgad
ieamtrsiegtarsmglvved
Download sequence
Identical sequences 2qamI 2j28_I 2rdo_I 3deg_H 3ep2_I 3eq3_I 3eq4_I 3j0d_G 3j5l_I 3j9z_LE 3ja1_LK 4csu_I 4u1u_BI 4u1u_DI 4u1v_BI 4u1v_DI 4u20_BI 4u20_DI 4u24_BI 4u24_DI 4u25_BI 4u25_DI 4u26_BI 4u26_DI 4u27_BI 4u27_DI 4uy8_I 4v47_AG 4v48_AG 4v4q_BI 4v4q_DI 4v50_BI 4v50_DI 4v52_BI 4v52_DI 4v53_BI 4v53_DI 4v54_BI 4v54_DI 4v55_BI 4v55_DI 4v56_BI 4v56_DI 4v57_BI 4v57_DI 4v5b_AI 4v5b_CI 4v5h_BI 4v5y_BI 4v5y_DI 4v64_BI 4v64_DI 4v69_BI 4v6m_BI 4v6n_AK 4v6o_BK 4v6p_BK 4v6q_BK 4v6r_BK 4v6s_AK 4v6t_BI 4v6v_BK 4v7c_BK 4v7d_AK 4v7s_BI 4v7s_DI 4v7t_BI 4v7t_DI 4v7u_BI 4v7u_DI 4v7v_BI 4v7v_DI 4v9d_CI 4v9d_DI 4wf1_BI 4wf1_DI 4www_RI 4www_YI 5aka_I 5h5u_J 5lza_I 5lzb_I 5lzc_I 5lzd_I 5lze_I 5lzf_I 5np6_g 5o2r_I 5uyk_11 5uyl_11 5uym_11 5uyn_11 5uyp_11 5uyq_11 5wdt_I 5we4_I 5we6_I 5wf0_I 5wfk_I 5wfs_I 6bu8_11 6gwt_I 6gxm_I 6gxn_I 6gxo_I 6gxp_I

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]