SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3kdf_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3kdf_D
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.27e-44
Family Single strand DNA-binding domain, SSB 0.000000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3kdf_D
Sequence length 132
Comment mol:protein length:132 Replication protein A 32 kDa subunit
Sequence
sraqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaa
pmdvrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthil
evinahmvlska
Download sequence
Identical sequences 3kdf_B 3kdf_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]