SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3khe_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3khe_A
Domain Number 1 Region: 10-183
Classification Level Classification E-value
Superfamily CATH 4.34e-45
Family CATH 0.00000169
Further Details:      
 
Domain Number 2 Region: 37-184
Classification Level Classification E-value
Superfamily EF-hand 5.81e-41
Family Calmodulin-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3khe_A
Sequence length 191
Comment mol:protein length:191 Calmodulin-like domain protein kinase isoform 3
Sequence
gkhaltgalgnmkkfqssqklaqaamlfmgsklttleetkeltqifrqldnngdgqldrk
eliegyrklmqwkgdtvsdldssqieaevdhilqsvdfdrngyieysefvtvcmdkqlll
srerllaafqqfdsdgsgkitneelgrlfgvtevddetwhqvlqecdknndgevdfeefv
emmqkicdvkv
Download sequence
Identical sequences 3khe_A 3khe_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]