SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3l9f_C from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3l9f_C
Domain Number 1 Region: 40-200
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.28e-39
Family SCOPe 0.0076
Further Details:      
 
Domain Number 2 Region: 3-40
Classification Level Classification E-value
Superfamily PDB 0.0000000036
Family PDB 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3l9f_C
Sequence length 204
Comment mol:protein length:204 Putative uncharacterized protein smu.1604c
Sequence
mgsshhhhhhssglvprgshmasmtggqqmgrgsmqgkdiilgilskkersgyeindilq
nqlsyfydgtygmiyptlrklekdgkitkevviqdgrpnkniyaitesgkkelasylqsd
vndeifksdflmrlffgnslndddleqlireeierkeekikrlsenleiwkkkgeltptq
eitikyglaqykstkkvleeelak
Download sequence
Identical sequences 3l9f_A 3l9f_B 3l9f_C 3l9f_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]