SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3ml6_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3ml6_B
Domain Number 1 Region: 121-384
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 4.98e-112
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000000724
Further Details:      
 
Domain Number 2 Region: 15-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.24e-33
Family DEP domain 0.00000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3ml6_B
Sequence length 385
Comment mol:protein length:385 Chimeric complex between protein Dishevlled2 homolog dvl-2 and clathrin adaptor AP-2 complex subunit mu
Sequence
galsvhmdmasvtkamaapesglevrdrmwlkitipnaflgsdvvdwlyhhvegfperre
arkyasgllkaglirhtvnkitfseqcyyvfgdlsggprpyspqpppyhelefggsggsr
nelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmndkiviekqgkgta
detsksgkqsiaiddctfhqcvrlskfdsersisfippdgefelmryrttkdiilpfrvi
plvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasena
ivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepk
lnysdhdvikwvryigrsgiyetrc
Download sequence
Identical sequences 3ml6_A 3ml6_B 3ml6_C 3ml6_D 3ml6_E 3ml6_F

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]