SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3mz1_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3mz1_A
Domain Number 1 Region: 86-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.86e-46
Family SCOPe 0.074
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.44e-18
Family LysR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3mz1_A
Sequence length 300
Comment mol:protein length:300 Putative transcriptional regulator
Sequence
qgmraflrvvetgnftrasaslnmpkatvtnliqgleahlrtkllnrttrrvlvtpdgal
yyeraarllsdldeldgslstaqslpkgrlrvetasafanlviipalpefhkkypdiqid
lgvsdrtidylaenvdcairagtltdqsliarritemkfvacasrdflerhpvpqhpsdl
ekncyvvgyflpktgqqmpfhfrrgneeievsgrytmaanesttylaaaraglgviqapl
fmvredlrngtmvpvlpdwqvepmpiylvyppnrhlssrlrvfadwvvkvmaqsqngegs
Download sequence
Identical sequences 3mz1_A 3mz1_B 3mz1_C 3mz1_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]