SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3p8v_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3p8v_A
Domain Number 1 Region: 7-290
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.31e-56
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3p8v_A
Sequence length 294
Comment mol:protein length:294 AsnS-like asparaginyl-tRNA synthetase related protein
Sequence
MNAVEIISRDIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWPDPAGEGIRP
AEVDVYGVRMRLTHSMILHKQLAIAMGLEKIFVLSPNIRLESRRKDDGRHSYEFTQLDFE
IEGAKMKDVMRLIEELIYGLFRKAEEWTGREFPRARHFKVYDYKDILEEFGSDEKASMEM
EEPFWIVNIPREFYDREENGVWKNYDLILPYGYGEVSSGGEREWEYEKIVAKIRAAGLKE
DSFRPYLEIARAGKLKPSAGAGIGVERLVRFIVGAKHIAEVQPFPRVPGIPAVI
Download sequence
Identical sequences Q9V228
3p8t_A 3p8t_B 3p8v_A 3p8v_B 3p8y_A 3p8y_B 3reu_A 3reu_B 3rex_A 3rex_B 3rl6_A 3rl6_B gi|14520464|ref|NP_125939.1| 272844.PAB2356 WP_010867370.1.84333 000144253|e3p8tA1|314.1.1.5|A:1-294 000427132|e3p8tB1|314.1.1.5|B:1-294 000427133|e3p8vA1|314.1.1.5|A:1-294 000427134|e3p8vB1|314.1.1.5|B:1-294 000427135|e3p8yA1|314.1.1.5|A:1-294 000427136|e3p8yB1|314.1.1.5|B:1-294 000427154|e3reuA1|314.1.1.5|A:1-294 000427155|e3reuB1|314.1.1.5|B:1-294 000427156|e3rexA1|314.1.1.5|A:1-294 000427157|e3rexB1|314.1.1.5|B:1-294 000427160|e3rl6A1|314.1.1.5|A:1-294 000427161|e3rl6B1|314.1.1.5|B:1-294 cath|current|3p8tA00/1-294 cath|current|3p8tB00/1-294 cath|current|3p8vA00/1-294 cath|current|3p8vB00/1-294 cath|current|3p8yA00/1-294 cath|current|3p8yB00/1-294 cath|current|3reuA00/1-294 cath|current|3reuB00/1-294 cath|current|3rexA00/1-294 cath|current|3rexB00/1-294 cath|current|3rl6A00/1-294 cath|current|3rl6B00/1-294 d3p8ta_ d3p8tb_ d3p8va_ d3p8vb_ d3p8ya_ d3p8yb_ d3reua_ d3reub_ d3rexa_ d3rexb_ d3rl6a_ d3rl6b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]