SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3r61_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3r61_B
Domain Number 1 Region: 62-131
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 2.42e-19
Family Iron-dependent repressor protein, dimerization domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.16e-17
Family Iron-dependent repressor protein 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3r61_B
Sequence length 141
Comment mol:protein length:141 Transcriptional regulator mntR
Sequence
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
ltskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfe
eddarkkdlksiqkktehhnq
Download sequence
Identical sequences 3r60_A 3r60_B 3r61_A 3r61_B 4hv5_A 4hv5_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]