SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3riq_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3riq_A
Domain Number 1 Region: 3-543
Classification Level Classification E-value
Superfamily Pectin lyase-like 0
Family SCOPe 0.00000000000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3riq_A
Sequence length 543
Comment mol:protein length:543 Tailspike protein
Sequence
avfrseadkkfkysvklsdymtlqeaataavdsllididynfidgeavdfggkvltieck
akfigdgvlnwnnlgsgskvisphmhtkttpytvyrfddngnwvtnpttvlasvaqrldk
gykpnvndhdiwaslpdnvknqvagatlrvnsanniifthpeatmggylftlcnhilves
prnfiawesgitfenhhttawgtgnkvvggeikygsgsavlfirndggddhdggvrdlis
yrvgesgvktyqneiggrsarnyrlvfdnittiqcyydgidvnadtgsptervddytlae
ypwfqlptqhiirniitrdcmgigawwdgqkniidnvvtyeahkegmfdrgtnnditnit
vvcankdltnlnqivceggsrlrgimvhayttqgyavyapssevsnvscagsgtkkilct
yvadiqggninvqhgenamtlsmrpamggtinpslvltadcqvaspgneasivklsaiqd
garvgelqlnrlgfkhmsipvaesqlpesalefnssigfffgtddelrilakkpdgtfvt
ysl
Download sequence
Identical sequences cath|current|3riqA00/133-673 3riq_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]