SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3unb_4 from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3unb_4
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.23e-79
Family Proteasome subunits 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3unb_4
Sequence length 205
Comment mol:protein length:205 Proteasome subunit beta type-6
Sequence
ttimavqfnggvvlgadsrtttgsyianrvtdkltpihdhifccrsgsaadtqavadavt
yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
vrqsfaiggsgssyiygyvdatyregmtkdeclqftanalalamerdgssggvirlaaiq
esgverqvllgdqipkftiatlppp
Download sequence
Identical sequences 3unb_4 3unb_N 3unb_b 3unb_p 3une_4 3une_N 3une_b 3une_p cath|current|3unb400/1-202 cath|current|3unbN00/1-202 cath|current|3unbb00/1-202 cath|current|3unbp00/1-202 cath|current|3une400/1-202 cath|current|3uneN00/1-202 cath|current|3uneb00/1-202 cath|current|3unep00/1-202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]