SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3unb_U from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3unb_U
Domain Number 1 Region: 13-244
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.52e-95
Family Proteasome subunits 0.00000000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3unb_U
Sequence length 246
Comment mol:protein length:246 Proteasome subunit alpha type-6
Sequence
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
Download sequence
Identical sequences A0A2K6RFH0 Q9QUM9
3unb_G 3unb_U 3unb_i 3unb_w 3une_G 3une_U 3une_i 3une_w 3unf_G 3unf_U 3unh_G 3unh_U ENSMUSP00000021412 NP_036098.1.92730 XP_010383847.1.97406 10090.ENSMUSP00000021412 cath|current|3unbG00/1-243 cath|current|3unbU00/1-243 cath|current|3unbi00/1-243 cath|current|3unbw00/1-243 cath|current|3uneG00/2-245 cath|current|3uneU00/2-245 cath|current|3unei00/2-245 cath|current|3unew00/2-245 cath|current|3unfG00/1-243 cath|current|3unfU00/1-243 cath|current|3unhG00/1-243 cath|current|3unhU00/1-243 ENSMUSP00000123914 ENSMUSP00000021412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]