SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3vst_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3vst_B
Domain Number 1 Region: 18-88,215-485
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.27e-45
Family Pectin methylesterase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3vst_B
Sequence length 638
Comment mol:protein length:638 Xylosidase
Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRR
ITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEK
KHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREK
TTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGL
IGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNG
WSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLH
AAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSS
EYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIF
IGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFE
KEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESP
DGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Download sequence
Identical sequences A0A2H4ULL2 A2ICH1 W9ECG8
gi|390934049|ref|YP_006391554.1| gi|390934049|ref|YP_006391554.1| WP_014757858.1.3173 3vst_A 3vst_B 3vst_C 3vst_D 3vsu_A 3vsu_B 3vsu_C 3vsu_D 3vsv_A 3vsv_B 3vsv_C 3vsv_D

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]