SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3zl5_F from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3zl5_F
Domain Number 1 Region: 44-218
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.26e-105
Family SCOPe 0.00023
Further Details:      
 
Domain Number 2 Region: 4-33
Classification Level Classification E-value
Superfamily PDB 0.00000000000193
Family PDB 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3zl5_F
Sequence length 222
Comment mol:protein length:222 PEROXIREDOXIN I
Sequence
mrgshhhhhhgmasmtggqqmgrdlyddddkdrwgstmvllpnrpapefkgqavingefk
eiclkdyrgkyvvlffypadftfvspteiiafsdqveefnsrncqviacstdsqyshlaw
dnldrksgglghmkiplladrkqeiskaygvfdeedgnafrglfiidpngilrqitindk
pvgrsvdetlrlldafqfvekhgevcpvnwkrgqhgikvnqk
Download sequence
Identical sequences 3zl5_A 3zl5_B 3zl5_C 3zl5_D 3zl5_E 3zl5_F 3zl5_G 3zl5_H 3zl5_I 3zl5_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]