SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3zyw_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3zyw_A
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.95e-45
Family Thioltransferase 0.0000695
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3zyw_A
Sequence length 111
Comment mol:protein length:111 GLUTAREDOXIN-3
Sequence
mkedlnlrlkklthaapcmlfmkgtpqeprcgfskqmveilhkhniqfssfdifsdeevr
qglkaysswptypqlyvsgeliggldiikeleaseeldticpkaaenlyfq
Download sequence
Identical sequences 3zyw_A 3zyw_B 001197322|e3zywB2|2485.1.1.21|B:1-111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]