SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4agv_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4agv_A
Domain Number 1 Region: 27-117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-17
Family Galectin (animal S-lectin) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4agv_A
Sequence length 146
Comment mol:protein length:146 GALECTIN
Sequence
vgpiqsikvdpmksgglgvvyrspdkgrvslylyndgedillvvdarfdwrgeqnvlvln
skfaggewgpevrpegfpfpccgyvttitvrveigadgftlsangieivkypyrdglppp
vtkfqyvfqdqgasetaqleslsayy
Download sequence
Identical sequences 4agg_A 4agg_B 4agr_A 4agr_B 4agr_C 4agr_D 4agv_A 4agv_B 4agv_C 4agv_D cath|current|4aggA00/3-146 cath|current|4aggB00/3-146 cath|current|4agrA00/3-146 cath|current|4agrB00/3-146 cath|current|4agrC00/3-146 cath|current|4agrD00/3-146 cath|current|4agvA00/3-146 cath|current|4agvB00/3-146 cath|current|4agvC00/3-146 cath|current|4agvD00/3-146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]