SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4bow_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4bow_B
Domain Number 1 Region: 12-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-89
Family SCOPe 0.000000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4bow_B
Sequence length 256
Comment mol:protein length:256 ENDO-1,3-BETA-GLUCANASE, FAMILY GH16
Sequence
hhhhhhgsafntlvfsdefeyegkpdpekwhyqvippnngswhnnelqhytnrsensfvs
dgtlkiraikekytfegstkdytsarlnskfaftygkvevraklpskkgtwpaiwtlgan
snetgnyfgeqygnaewpacgsidileqngwdkestiahfhwsdlnsdeyqnlggttpit
nasgsfhvyslewnasamkvflddtlvyelknsqntpynaphylllniamggtlggdipe
nftddifeidyvriyq
Download sequence
Identical sequences cath|current|4bowA00/136-383 cath|current|4bowB00/136-383 cath|current|4bpzA00/133-383 cath|current|4bpzB00/132-383 4bow_A 4bow_B 4bpz_A 4bpz_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]