SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4crq_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4crq_A
Domain Number 1 Region: 5-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.13e-106
Family SCOPe 0.000000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4crq_A
Sequence length 233
Comment mol:protein length:233 ENDO-1,3-BETA-GLUCANASE, FAMILY GH16
Sequence
QDYNLVWQDEFDDGIGPDWVFETGMGYNGWGNNELQYYRRENAAVENGNLVITAKHENFG
GAQYTSARMKTQGRKSFKYGKIEARIALPSGQGLWPAFWMLGNNITSVSWPACGEIDIMS
RINNALQTHGTIHWSDQNGDHASYGDDVGVSDPGQYHIYSVEWDANSIKWFVDGQQFNEV
DISNGVNGTGEFQNEFFILLNMAVGGDWPGFDVDQSKLPAQMLVDYVRVYQKG
Download sequence
Identical sequences 4crq_A 4crq_B 4cte_A 4cte_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]