SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4d73_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4d73_B
Domain Number 1 Region: 4-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.52e-32
Family Glutathione peroxidase-like 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4d73_B
Sequence length 180
Comment mol:protein length:180 1-CYS PEROXIREDOXIN
Sequence
IKENDLIPNVKVMIDVRNMNNISDTDGSPNDFTSIDTHELFNNKKILLISMPGAFTPTCS
TKMIPGYEEEYDYFIKENNFDDIYCITNNDIYVLKSWFKSMDIKKIKYISDGNSSFTDSM
NMLVDKSNFFMGMRPWRFVAIVENNILVKMFQEKDKQHNIQTDPYDISTVNNVKEFLKNN
Download sequence
Identical sequences 001554152|e4d73A1|2485.1.1.34|A:1-180 d4d73a_ 4d73_A 4d73_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]