SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4f82_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4f82_A
Domain Number 1 Region: 11-120,156-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.46e-47
Family SCOPe 0.000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4f82_A
Sequence length 176
Comment mol:protein length:176 Thioredoxin Reductase
Sequence
mahhhhhhmiqvgdalpdaqlfefiddaregctlgpnacsvrdqvagkrvvifglpgaft
ptcsaqhvpgyvehaeqlraagideiwcvsvndafvmgawgrdlhtagkvrmmadgsaaf
thalgltqdlsargmgirslryamvidggvvktlaveapgkfevsdaasvlatlts
Download sequence
Identical sequences cath|current|4f82A00/-2-168 cath|current|4f82B00/0-168 4f82_A 4f82_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]