SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4ga9_B from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4ga9_B
Domain Number 1 Region: 11-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.54e-50
Family Galectin (animal S-lectin) 0.0000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4ga9_B
Sequence length 134
Comment mol:protein length:134 Galectin-1
Sequence
acglvasnlnlkpgeclkvrgelapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskddgtwgteqretafpfqpgsitevcitfdqadltiklpdghefkfpnrlnmeainym
aadgdfkvkcvafe
Download sequence
Identical sequences 4ga9_A 4ga9_B 001088157|e4ga9A1|10.1.1.171|A:1-134 001088158|e4ga9B1|10.1.1.171|B:1-134 cath|current|4ga9A00/2-135 cath|current|4ga9B00/2-135 d4ga9a_ d4ga9b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]