SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4gcv_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4gcv_A
Domain Number 1 Region: 11-123
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.77e-52
Family SCOPe 0.00000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4gcv_A
Sequence length 168
Comment mol:protein length:168 Putative transcription protein
Sequence
mqrktfadaecpiarslervgewwsilimrdalqglrrfdefsrsldiapnmltrrlnal
veagllerqpysqrplryqyvptakgedfrvvlmafvawgnrhyaqqgqsvqlvertsgr
pvrsfmaaladgrtvpleqctvqagpaaseemrqrlaamperselpar
Download sequence
Identical sequences 4gcv_A 4gcv_B 4gcv_C 4gcv_D 4gcv_E 4gcv_F 4gcv_G 4gcv_H 4gcv_I 4gcv_J 4gcv_K 4gcv_L

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]