SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4in0_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4in0_A
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.1e-26
Family SCOPe 0.00000619
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4in0_A
Sequence length 148
Comment mol:protein length:148 Thioredoxin-like protein 4B
Sequence
sfllpkltskkevdqaikstaekvlvlrfgrdedpvclqlddilsktssdlskmaaiylv
dvdqtavytqyfdisyipstvfffngqhmkvdygspdhtkfvgsfktkqdfidlieviyr
gamrgklivqspidpknipkydllyqdi
Download sequence
Identical sequences cath|current|4in0A00/2-142 cath|current|4in0B00/2-142 4in0_A 4in0_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]