SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4inr_D from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4inr_D
Domain Number 1 Region: 12-247
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.07e-86
Family Proteasome subunits 0.00000000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4inr_D
Sequence length 260
Comment mol:protein length:260 Proteasome component PUP2
Sequence
MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLE
SDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLA
LRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQ
AELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELI
KELKEKEAAESPEEADVEMS
Download sequence
Identical sequences A0A0L8VPR8 A0A250WCR1 A6ZUR1 B3LHY7 C7GNH7 C8Z9E5 E7KD40 E7KNW1 E7LV10 E7NI78 E7Q4E1 E7QFC0 G2WEX9 H0GGY3 N1P678 P32379
YGR253C YGR253C 1z7qE YGR253C YGR253C YGR253C YGR253C YGR253C YGR253C tr|A6ZUR1|A6ZUR1_YEAS7 YGR253C YGR253C YGR253C cath|current|1fntE00/7-250 cath|current|1fntS00/7-250 cath|current|1z7qE00/6-250 cath|current|1z7qS00/6-250 cath|current|2zcyD00/9-244 cath|current|2zcyR00/9-244 cath|current|3bdmD00/9-244 cath|current|3bdmR00/9-244 cath|current|3nzjD00/9-244 cath|current|3nzjR00/9-244 cath|current|3nzwD00/9-244 cath|current|3nzwR00/9-244 cath|current|3nzxD00/9-244 cath|current|3nzxR00/9-244 cath|current|3oeuD00/9-244 cath|current|3oeuR00/9-244 cath|current|3oevD00/9-244 cath|current|3oevR00/9-244 cath|current|3sdiD00/12-244 cath|current|3sdiR00/12-244 cath|current|3sdkD00/9-244 cath|current|3sdkR00/9-244 cath|current|3un4D00/1-242 cath|current|3un4R00/1-242 cath|current|3un8D00/1-242 cath|current|3un8R00/1-242 cath|current|3wxrE00/9-250 cath|current|3wxrS00/9-250 cath|current|4inrD00/1-242 cath|current|4inrR00/1-242 cath|current|4intD00/1-242 cath|current|4intR00/1-242 cath|current|4inuD00/1-242 cath|current|4inuR00/1-242 cath|current|4j70D00/1-242 cath|current|4j70R00/1-242 cath|current|4jsqD00/1-242 cath|current|4jsqR00/1-242 cath|current|4jsuD00/1-242 cath|current|4jsuR00/1-242 cath|current|4jt0D00/1-242 cath|current|4jt0R00/1-242 cath|current|4ltcD00/1-242 cath|current|4ltcR00/1-242 cath|current|4nnnD00/1-242 cath|current|4nnnR00/1-242 cath|current|4nnwD00/1-242 cath|current|4nnwR00/1-242 cath|current|4no1D00/1-242 cath|current|4no1R00/1-242 cath|current|4no6D00/1-242 cath|current|4no6R00/1-242 cath|current|4no8D00/1-242 cath|current|4no8R00/1-242 cath|current|4no9D00/1-242 cath|current|4no9R00/1-242 cath|current|4q1sD00/1-242 cath|current|4q1sR00/1-242 cath|current|4qbyD00/1-242 cath|current|4qbyR00/1-242 cath|current|4qlqD00/1-242 cath|current|4qlqR00/1-242 cath|current|4qlsD00/1-242 cath|current|4qlsR00/1-242 cath|current|4qltD00/1-242 cath|current|4qltR00/1-242 cath|current|4qluD00/1-242 cath|current|4qluR00/1-242 cath|current|4qlvD00/1-242 cath|current|4qlvR00/1-242 cath|current|4r02D00/1-242 cath|current|4r02R00/1-242 cath|current|4r17D00/1-242 cath|current|4r17R00/1-242 cath|current|4r18D00/1-242 cath|current|4r18R00/1-242 cath|current|4rurD00/1-242 cath|current|4rurR00/1-242 YGR253C YGR253C YGR253C YGR253C 1fnt_E 1fnt_S 1z7q_E 1z7q_S 2zcy_D 2zcy_R 3bdm_D 3bdm_R 3jco_E 3jco_e 3jcp_E 3jcp_e 3nzj_D 3nzj_R 3nzw_D 3nzw_R 3nzx_D 3nzx_R 3oeu_D 3oeu_R 3oev_D 3oev_R 3sdi_D 3sdi_R 3sdk_D 3sdk_R 3un4_D 3un4_R 3un8_D 3un8_R 3wxr_E 3wxr_S 4cr2_E 4cr3_E 4cr4_E 4inr_D 4inr_R 4int_D 4int_R 4inu_D 4inu_R 4j70_D 4j70_R 4jsq_D 4jsq_R 4jsu_D 4jsu_R 4jt0_D 4jt0_R 4ltc_D 4ltc_R 4nnn_D 4nnn_R 4nnw_D 4nnw_R 4no1_D 4no1_R 4no6_D 4no6_R 4no8_D 4no8_R 4no9_D 4no9_R 4q1s_D 4q1s_R 4qby_D 4qby_R 4qlq_D 4qlq_R 4qls_D 4qls_R 4qlt_D 4qlt_R 4qlu_D 4qlu_R 4qlv_D 4qlv_R 4qux_D 4qux_R 4quy_D 4quy_R 4qv0_D 4qv0_R 4qv1_D 4qv1_R 4qv3_D 4qv3_R 4qv4_D 4qv4_R 4qv5_D 4qv5_R 4qv6_D 4qv6_R 4qv7_D 4qv7_R 4qv8_D 4qv8_R 4qv9_D 4qv9_R 4qvl_D 4qvl_R 4qvm_D 4qvm_R 4qvn_D 4qvn_R 4qvp_D 4qvp_R 4qvq_D 4qvq_R 4qvv_D 4qvv_R 4qvw_D 4qvw_R 4qvy_D 4qvy_R 4qw0_D 4qw0_R 4qw1_D 4qw1_R 4qw3_D 4qw3_R 4qw4_D 4qw4_R 4qw5_D 4qw5_R 4qw6_D 4qw6_R 4qw7_D 4qw7_R 4qwf_D 4qwf_R 4qwg_D 4qwg_R 4qwi_D 4qwi_R 4qwj_D 4qwj_R 4qwk_D 4qwk_R 4qwl_D 4qwl_R 4qwr_D 4qwr_R 4qws_D 4qws_R 4qwu_D 4qwu_R 4qwx_D 4qwx_R 4qxj_D 4qxj_R 4qz0_D 4qz0_R 4qz1_D 4qz1_R 4qz2_D 4qz2_R 4qz3_D 4qz3_R 4qz4_D 4qz4_R 4qz5_D 4qz5_R 4qz6_D 4qz6_R 4qz7_D 4qz7_R 4qzw_D 4qzw_R 4qzx_D 4qzx_R 4qzz_D 4qzz_R 4r00_D 4r00_R 4r02_D 4r02_R 4r17_D 4r17_R 4r18_D 4r18_R 4rur_D 4rur_R 4x6z_E 4x6z_S 4y69_D 4y69_R 4y6a_D 4y6a_R 4y6v_D 4y6v_R 4y6z_D 4y6z_R 4y70_D 4y70_R 4y74_D 4y74_R 4y75_D 4y75_R 4y77_D 4y77_R 4y78_D 4y78_R 4y7w_D 4y7w_R 4y7x_D 4y7x_R 4y7y_D 4y7y_R 4y80_D 4y80_R 4y81_D 4y81_R 4y82_D 4y82_R 4y84_D 4y84_R 4y8g_D 4y8g_R 4y8h_D 4y8h_R 4y8i_D 4y8i_R 4y8j_D 4y8j_R 4y8k_D 4y8k_R 4y8l_D 4y8l_R 4y8m_D 4y8m_R 4y8n_D 4y8n_R 4y8o_D 4y8o_R 4y8p_D 4y8p_R 4y8q_D 4y8q_R 4y8r_D 4y8r_R 4y8s_D 4y8s_R 4y8t_D 4y8t_R 4y8u_D 4y8u_R 4y9y_D 4y9y_R 4y9z_D 4y9z_R 4ya0_D 4ya0_R 4ya1_D 4ya1_R 4ya2_D 4ya2_R 4ya3_D 4ya3_R 4ya4_D 4ya4_R 4ya5_D 4ya5_R 4ya7_D 4ya7_R 4ya9_D 4ya9_R 4z1l_D 4z1l_R 5a5b_E 5ahj_D 5ahj_R 5bou_D 5bou_R 5bxl_D 5bxl_R 5bxn_D 5bxn_R 5cgf_D 5cgf_R 5cgg_D 5cgg_R 5cgh_D 5cgh_R 5cgi_D 5cgi_R 5cz4_D 5cz4_R 5cz5_D 5cz5_R 5cz6_D 5cz6_R 5cz7_D 5cz7_R 5cz8_D 5cz8_R 5cz9_D 5cz9_R 5cza_D 5cza_R 5d0s_D 5d0s_R 5d0t_D 5d0t_R 5d0v_D 5d0v_R 5d0w_D 5d0w_R 5d0x_D 5d0x_R 5d0z_D 5d0z_R 5dki_D 5dki_R 5dkj_D 5dkj_R 5fg7_D 5fg7_R 5fg9_D 5fg9_R 5fga_D 5fga_R 5fgd_D 5fgd_R 5fge_D 5fge_R 5fgf_D 5fgf_R 5fgg_D 5fgg_R 5fgh_D 5fgh_R 5fgi_D 5fgi_R 5fhs_D 5fhs_R 5jhr_D 5jhr_R 5jhs_D 5jhs_R 5l52_D 5l52_R 5l54_D 5l54_R 5l55_D 5l55_R 5l5a_D 5l5a_R 5l5b_D 5l5b_R 5l5d_D 5l5d_R 5l5e_D 5l5e_R 5l5f_D 5l5f_R 5l5h_D 5l5h_R 5l5i_D 5l5i_R 5l5j_D 5l5j_R 5l5o_D 5l5o_R 5l5p_D 5l5p_R 5l5q_D 5l5q_R 5l5r_D 5l5r_R 5l5s_D 5l5s_R 5l5t_D 5l5t_R 5l5u_D 5l5u_R 5l5v_D 5l5v_R 5l5w_D 5l5w_R 5l5x_D 5l5x_R 5l5y_D 5l5y_R 5l5z_D 5l5z_R 5l60_D 5l60_R 5l61_D 5l61_R 5l62_D 5l62_R 5l63_D 5l63_R 5l64_D 5l64_R 5l65_D 5l65_R 5l66_D 5l66_R 5l67_D 5l67_R 5l68_D 5l68_R 5l69_D 5l69_R 5l6a_D 5l6a_R 5l6b_D 5l6b_R 5l6c_D 5l6c_R 5lai_D 5lai_R 5laj_D 5laj_R 5ltt_D 5ltt_R 5m2b_D 5m2b_R 5mp9_E 5mp9_e 5mpa_E 5mpa_e 5mpb_E 5mpb_e 5mpc_E 5mpc_e 5nif_E 5nif_S 5wvi_E 5wvi_m 5wvk_E 5wvk_m 6ef3_E 6g7f_D 6g7f_R 6g8m_D 6g8m_R 6g8n_D 6g8n_R 6gop_D 6gop_R YGR253C 4932.YGR253C NP_011769.1.97178 SCRT_00771 YGR253C YGR253C YGR253C YGR253C YGR253C YGR253C YGR253c___KOG0176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]