SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4isd_A from Protein Data Bank

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4isd_A
Domain Number 1 Region: 18-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.72e-24
Family SCOPe 0.069
Further Details:      
 
Domain Number 2 Region: 80-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000000476
Family SCOPe 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 4isd_A
Sequence length 220
Comment mol:protein length:220 Glutathione S-transferase
Sequence
mvmsqkpitlyvgadyvsafamsafvvlkekgldfeirtvdlkskqqhgsayrevsltrr
vptlqhdrftlsessaiaeyldevypaphyaavlpadretralarqlqawirsdfmplks
erqadriyfpepvkplgeaaqlacekllsaadrlidderygvfgdwciadtdfalmlnrl
vacgdpvppkvlryverqwarpsvqqwvkqkrdaenlyfq
Download sequence
Identical sequences 4isd_A 4isd_B 4isd_C 4isd_D 4isd_E

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]